Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial pyruvate carrier 1 (MPC1), partial, Biotinylated

This Recombinant Human Mitochondrial pyruvate carrier 1 (MPC1), partial, Biotinylated spans the amino acid sequence from region 72-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial pyruvate carrier 1; Brain protein 44-like protein; MPC1 BRP44L CGI-129 HSPC040 PNAS-115

UniProt

Q9Y5U8

Expression Region

72-109

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Hydroxy-1H-indole-3-carboxylic acid
TRC-H955488-25MG 25 mg

6-Hydroxy-1H-indole-3-carboxylic acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: carotid
CS508137 5x 5 µm

Frozen Tissue Sections, Artery: carotid

Sign In for Pricing
View Details
TCF4 (NM_003199) Human Over-expression Lysate
LC401106 20 µg

TCF4 (NM_003199) Human Over-expression Lysate

Sign In for Pricing
View Details
REA (PHB2) Rabbit Polyclonal Antibody
AP13988PU-N 400 µL

REA (PHB2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BMS 833923
TRC-B596320-25MG 25 mg

BMS 833923

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS700262 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details