Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tesmin (MTL5), Biotinylated

This Recombinant Human Tesmin (MTL5), Biotinylated spans the amino acid sequence from region 1-508. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tesmin; Metallothionein-like 5, testis-specific; Testis-specific metallothionein-like protein; TESMIN MTL5

UniProt

Q9Y4I5

Expression Region

1-508

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPLGAWVLEGASHPGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCIDNSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPPKITLAGYCDCFASGDFCNNCNCNNCCNNLHHDIERFKAIKACLGRNPEAFQPKIGKGQLGNVKPQHNKGCNCRRSGCLKNYCECYEAQIMCSSICKCIGCKNYEESPERKTLMSMPNYMQTGGLEGSHYLPPTKFSGLPRFSHDRRPSSCISWEVVEATCACLLAQGEEAEKEHCSKCLAEQMILEEFGRCLSQILHTEFKSKGLKME

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac 5-Hydroxy Valproic Acid-d7 Sodium Salt
TRC-H993012-1MG 1 mg

rac 5-Hydroxy Valproic Acid-d7 Sodium Salt

Sign In for Pricing
View Details
Human CLDN34 activation kit by CRISPRa
GA119240 1 Kit

Human CLDN34 activation kit by CRISPRa

Sign In for Pricing
View Details
SPINK7 (NM_032566) Human Recombinant Protein
TP318867L 1 mg

SPINK7 (NM_032566) Human Recombinant Protein

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-1F7), BSA-free, 1 mg/mL
BNUM1925-50 1x 50 µL

P53 Tumor Suppressor Protein (PCRP-TP53-1F7), BSA-free, 1 mg/mL

Sign In for Pricing
View Details
Carfilzomib (2R,4S)-2-Hydroxy Acetate
TRC-M687545-2.5MG 2.5 mg

Carfilzomib (2R,4S)-2-Hydroxy Acetate

Sign In for Pricing
View Details
NAP1L3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C3]
TA808548BM 100 µL

NAP1L3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C3]

Sign In for Pricing
View Details