Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-10 (LV310), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 3-10 (LV310), Biotinylated spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-10 IGLV3-10

UniProt

A0A075B6K4

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SYELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQKSGQAPVLVIYEDSKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti human vitronectin antiserum
MBS135320-01 1 mL

Rabbit anti human vitronectin antiserum

Sign In for Pricing
View Details
Rabbit anti human vitronectin antiserum
MBS135320-02 10 mL

Rabbit anti human vitronectin antiserum

Sign In for Pricing
View Details
Rabbit anti human vitronectin antiserum
MBS135320-03 5x 10 mL

Rabbit anti human vitronectin antiserum

Sign In for Pricing
View Details
DDX6 Mouse Monoclonal Antibody [Clone ID: LBI3E2]
AMM16479V 100 µL

DDX6 Mouse Monoclonal Antibody [Clone ID: LBI3E2]

Sign In for Pricing
View Details
CPEB1 (NM_001079533) Human Untagged Clone
SC315781 10 µg

CPEB1 (NM_001079533) Human Untagged Clone

Sign In for Pricing
View Details
Ndufaf3-set siRNA/shRNA/RNAi Lentivector (Rat)
31634096 4x 500 ng

Ndufaf3-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details