Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-10 (LV310), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 3-10 (LV310), Biotinylated spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-10 IGLV3-10

UniProt

A0A075B6K4

Expression Region

20-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SYELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQKSGQAPVLVIYEDSKRPSGIPERFSGSSSGTMATLTISGAQVEDEADYYCYSTDSSGNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Finger CCHC Domain-Containing Protein 11 (ZCCHC11) Antibody
abx239610 100 µg

Zinc Finger CCHC Domain-Containing Protein 11 (ZCCHC11) Antibody

Sign In for Pricing
View Details
PSG9 Rabbit Polyclonal Antibody
orb3068785-01 30 µL

PSG9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PSG9 Rabbit Polyclonal Antibody
orb3068785-02 50 µL

PSG9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PSG9 Rabbit Polyclonal Antibody
orb3068785-03 100 µL

PSG9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PSG9 Rabbit Polyclonal Antibody
orb3068785-04 200 µL

PSG9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
COPG2 AAV siRNA Pooled Vector
16627161 1.0 µg

COPG2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details