Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-4 (HV404), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-4 (HV404), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-4 IGHV4-4

UniProt

A0A075B6R2

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Emx2 shRNA (UAS) - Lentiviral mouse Emx2 shRNA (UAS, GFP) plasmid
GTR15286258 1 Vial

Lentiviral mouse Emx2 shRNA (UAS) - Lentiviral mouse Emx2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Boc- (R) -alpha- (2-nitro- benzyl) -proline
CSB-DT3493 0.5 g

Boc- (R) -alpha- (2-nitro- benzyl) -proline

Sign In for Pricing
View Details
ZBTB2 Peptide
4961P 0.05 mg

ZBTB2 Peptide

Sign In for Pricing
View Details
Uncoated Human Ep-CAM/CD326 (Epithelial Cell Adhesion Molecule) ELISA Kit
MBS2578263-01 24 Tests (Limit 1)

Uncoated Human Ep-CAM/CD326 (Epithelial Cell Adhesion Molecule) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human Ep-CAM/CD326 (Epithelial Cell Adhesion Molecule) ELISA Kit
MBS2578263-02 5x 96 Tests

Uncoated Human Ep-CAM/CD326 (Epithelial Cell Adhesion Molecule) ELISA Kit

Sign In for Pricing
View Details
Anti-ATR Antibody , Carrier-free
A00262-2-carrier-free 100 µg/Vial

Anti-ATR Antibody , Carrier-free

Sign In for Pricing
View Details