Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-4 (HV404), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-4 (HV404), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-4 IGHV4-4

UniProt

A0A075B6R2

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQPPGKGLEWIGEIYHSGSTNYNPSLKSRVTISVDKSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DPEP1, N-His
MBS1573469-01 0.1 mg

Recombinant Human DPEP1, N-His

Sign In for Pricing
View Details
Recombinant Human DPEP1, N-His
MBS1573469-02 1 mg

Recombinant Human DPEP1, N-His

Sign In for Pricing
View Details
Recombinant Human DPEP1, N-His
MBS1573469-03 5x 1 mg

Recombinant Human DPEP1, N-His

Sign In for Pricing
View Details
Anti-JMJD6 antibody
STJ28403 100 µl

Anti-JMJD6 antibody

Sign In for Pricing
View Details
ZSCAN1, CT (ZSCAN1, Zinc finger and SCAN domain-containing protein 1)
044411 200 µL

ZSCAN1, CT (ZSCAN1, Zinc finger and SCAN domain-containing protein 1)

Sign In for Pricing
View Details
Z-L-aspartic acid beta-N-hydroxysuccinimide ester alpha-methyl ester
260722-01 500 mg

Z-L-aspartic acid beta-N-hydroxysuccinimide ester alpha-methyl ester

Sign In for Pricing
View Details