Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 23/delta variable 6 (TVA23), Biotinylated

This Recombinant Human T cell receptor alpha variable 23/delta variable 6 (TVA23), Biotinylated spans the amino acid sequence from region 22-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 23/delta variable 6 TRAV23DV6

UniProt

A0A075B6W5

Expression Region

22-121

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEKSDQQQVKQSPQSLIVQKGGISIINCAYENTAFDYFPWYQQFPGKGPALLIAIRPDVSEKKEGRFTISFNKSAKQFSSHIMDSQPGDSATYFCAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUCY1A3 Human shRNA Plasmid Kit (Locus ID 2982)
TL312559 1 Kit

GUCY1A3 Human shRNA Plasmid Kit (Locus ID 2982)

Sign In for Pricing
View Details
Anti-Neuritin NRN1 Antibody
A09989-1 100 µL

Anti-Neuritin NRN1 Antibody

Sign In for Pricing
View Details
KAT6B Rabbit Polyclonal Antibody (Cy5.5)
orb1069049 100 µL

KAT6B Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
LEAP-2 (38 - 77) (Human) (AA: Met-Thr-Pro-Phe-Trp-Arg-Gly-Val-Ser-Leu-Arg-Pro-Ile-Gly-Ala-Ser-Cys-Arg-Asp-Asp-Ser-Glu-Cys-Ile-Thr-Arg-Leu-Cys-Arg-Lys-Arg-Arg-Cys-Ser-Leu-Ser-Val-Ala-Gln-Glu) (MW: 4585.36)
SP-54841-1 1 mg

LEAP-2 (38 - 77) (Human) (AA: Met-Thr-Pro-Phe-Trp-Arg-Gly-Val-Ser-Leu-Arg-Pro-Ile-Gly-Ala-Ser-Cys-Arg-Asp-Asp-Ser-Glu-Cys-Ile-Thr-Arg-Leu-Cys-Arg-Lys-Arg-Arg-Cys-Ser-Leu-Ser-Val-Ala-Gln-Glu) (MW: 4585.36)

Sign In for Pricing
View Details
Rat Monoclonal CD68/SR-D1 Antibody (FA-11) [PE/Cy5.5]
NBP2-33337PECY55 0.1 mL

Rat Monoclonal CD68/SR-D1 Antibody (FA-11) [PE/Cy5.5]

Sign In for Pricing
View Details
Anti-CEA20 antibody
STJ190664 200 µl

Anti-CEA20 antibody

Sign In for Pricing
View Details