Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1), Biotinylated

This Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1), Biotinylated spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-1 TRAV26-1

UniProt

A0A087WT03

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCT, NT (DCT, TYRP2, L-dopachrome tautomerase, L-dopachrome Delta-isomerase, Tyrosinase-related protein 2) (APC) discontinued
034517-APC 200 µL

DCT, NT (DCT, TYRP2, L-dopachrome tautomerase, L-dopachrome Delta-isomerase, Tyrosinase-related protein 2) (APC) discontinued

Sign In for Pricing
View Details
PcDNA3.1 (+) -T8-SNAP
PPL01758-2a 1 Each

PcDNA3.1 (+) -T8-SNAP

Sign In for Pricing
View Details
Anti Human CD20 Pab
111237 100 µg

Anti Human CD20 Pab

Sign In for Pricing
View Details
SEZ6L shRNA Plasmid (m)
sc-153391-SH 20 µg

SEZ6L shRNA Plasmid (m)

Sign In for Pricing
View Details
FRMD1 rabbit pAb
E44H12522 100 µL

FRMD1 rabbit pAb

Sign In for Pricing
View Details
TAS2R43 Antibody : FITC (OAAF05304-FITC)
OAAF05304-100UG-FITC 100 µg

TAS2R43 Antibody : FITC (OAAF05304-FITC)

Sign In for Pricing
View Details