Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 14/delta variable 4 (TVA14), Biotinylated

This Recombinant Human T cell receptor alpha variable 14/delta variable 4 (TVA14), Biotinylated spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 14/delta variable 4 TRAV14DV4

UniProt

A0A0A6YYC5

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKITQTQPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10X1, ID (OR10X1, OR10X1P, Olfactory receptor 10X1, Olfactory receptor OR1-14) (PE) discontinued
039314-PE 200 µL

OR10X1, ID (OR10X1, OR10X1P, Olfactory receptor 10X1, Olfactory receptor OR1-14) (PE) discontinued

Sign In for Pricing
View Details
SUCLG1 Antibody
E38QA6089 100 µL

SUCLG1 Antibody

Sign In for Pricing
View Details
USP12 Antibody Blocking peptide
orb1451063 500 µg

USP12 Antibody Blocking peptide

Sign In for Pricing
View Details
Human Alpha Fetoprotein Antibody
OAMA00870-1MG 1 mg

Human Alpha Fetoprotein Antibody

Sign In for Pricing
View Details
Human Secretory Carrier-Associated Membrane Protein 3 (SCAMP3) ELISA Kit
orb1909639-01 48 Tests

Human Secretory Carrier-Associated Membrane Protein 3 (SCAMP3) ELISA Kit

Sign In for Pricing
View Details
Human Secretory Carrier-Associated Membrane Protein 3 (SCAMP3) ELISA Kit
orb1909639-02 96 Tests

Human Secretory Carrier-Associated Membrane Protein 3 (SCAMP3) ELISA Kit

Sign In for Pricing
View Details