Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 5 (TRGV5), Biotinylated

This Recombinant Human T cell receptor gamma variable 5 (TRGV5), Biotinylated spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 5 TRGV5 TCRGV5

UniProt

A0A0B4J1U4

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGGTKSVTRPTRSSAEITCDLTVINAFYIHWYLHQEGKAPQRLLYYDVSNSKDVLESGLSPGKYYTHTPRRWSWILILRNLIENDSGVYYCATWDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thiodiglycolic Anhydride
TRC-T344525-50G 50 g

Thiodiglycolic Anhydride

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS4), CF647 conjugate, 0.1mg/mL
BNC471744-100 1x 100 µL

Epstein-Barr Virus (LMP-1) (CS4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Papain-Like Protease Protein
PKSR030472-01 10 µg

Recombinant SARS-CoV-2 Papain-Like Protease Protein

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Papain-Like Protease Protein
PKSR030472-02 50 µg

Recombinant SARS-CoV-2 Papain-Like Protease Protein

Sign In for Pricing
View Details
PHD2 Antibody
OC-877-01 50 μL

PHD2 Antibody

Sign In for Pricing
View Details
PHD2 Antibody
OC-877-02 100 µL

PHD2 Antibody

Sign In for Pricing
View Details