Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-6 (TVA86), Biotinylated

This Recombinant Human T cell receptor alpha variable 8-6 (TVA86), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-6 TRAV8-6

UniProt

A0A0B4J262

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSQVPVFEEAPVELRCNYSSSVSVYLFWYVQYPNQGLQLLLKYLSGSTLVESINGFEAEFNKSQTSFHLRKPSVHISDTAEYFCAVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymine DNA glycosylase (TDG) Rabbit Polyclonal Antibody
AP06727PU-N 100 µg

Thymine DNA glycosylase (TDG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAF9 (NM_003187) Human Over-expression Lysate
LY418840 100 µg

TAF9 (NM_003187) Human Over-expression Lysate

Sign In for Pricing
View Details
MYST2 Antibody
8C10221-AAT 50 µg

MYST2 Antibody

Sign In for Pricing
View Details
RNaseRevealTM Activity Assay Kit
#31086 1 Kit

RNaseRevealTM Activity Assay Kit

Sign In for Pricing
View Details
cis-Ambroxol Hydrochloride
TRC-A576147-50MG 50 mg

cis-Ambroxol Hydrochloride

Sign In for Pricing
View Details
Ternidazole-d6 Hydrochloride (>90%)
TRC-T116502-1MG 1 mg

Ternidazole-d6 Hydrochloride (>90%)

Sign In for Pricing
View Details