Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 25 (TVA25), Biotinylated

This Recombinant Human T cell receptor alpha variable 25 (TVA25), Biotinylated spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 25 TRAV25

UniProt

A0A0B4J276

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQVMQIPQYQHVQEGEDFTTYCNSSTTLSNIQWYKQRPGGHPVFLIQLVKSGEVKKQKRLTFQFGEAKKNSSLHITATQTTDVGTYFCAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Spermatoza ELISA
MBS494117-01 96 Tests

Anti-Spermatoza ELISA

Sign In for Pricing
View Details
Anti-Spermatoza ELISA
MBS494117-02 5x 96 Tests

Anti-Spermatoza ELISA

Sign In for Pricing
View Details
Ppp1r10 (NM_175934) Mouse Untagged Clone
MC222322 10 µg

Ppp1r10 (NM_175934) Mouse Untagged Clone

Sign In for Pricing
View Details
Tyrosyl-CNP-22 (Human)
MDP0629 500 µg

Tyrosyl-CNP-22 (Human)

Sign In for Pricing
View Details
EPS8 Antibody Blocking Peptide
orb1504731 500 µg

EPS8 Antibody Blocking Peptide

Sign In for Pricing
View Details
Isookanin
HY-N7677-01 5 mg

Isookanin

Sign In for Pricing
View Details