Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-58 (HV158), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-58 (HV158), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-58 IGHV1-58

UniProt

A0A0C4DH39

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QMQLVQSGPEVKKPGTSVKVSCKASGFTFTSSAVQWVRQARGQRLEWIGWIVVGSGNTNYAQKFQERVTITRDMSTSTAYMELSSLRSEDTAVYYCAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASB13 Protein Vector (Mouse) (pPM-C-HA)
12506025 500 ng

ASB13 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Transforming Growth Factor Beta Induced Protein (TGFbI) Antibody (APC)
abx178678-01 200 µg

Transforming Growth Factor Beta Induced Protein (TGFbI) Antibody (APC)

Sign In for Pricing
View Details
Transforming Growth Factor Beta Induced Protein (TGFbI) Antibody (APC)
abx178678-02 1 mg

Transforming Growth Factor Beta Induced Protein (TGFbI) Antibody (APC)

Sign In for Pricing
View Details
Fmoc-D-Phe(4-CF3)-OH
MBS3848267-01 100 mg

Fmoc-D-Phe(4-CF3)-OH

Sign In for Pricing
View Details
Fmoc-D-Phe(4-CF3)-OH
MBS3848267-02 5x 100 mg

Fmoc-D-Phe(4-CF3)-OH

Sign In for Pricing
View Details
Goat Calreticulin-3 (CALR3) ELISA Kit
MBS7243854-01 48 Well

Goat Calreticulin-3 (CALR3) ELISA Kit

Sign In for Pricing
View Details