Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Human (HEK293)

IFN-gamma is a cytokine. IFN-gamma can exert anticancer effects by activating p53 and p21, leading to cell cycle arrest, and/or by activating IRF-1 and Caspase-1, leading to pyroptosis, and by activating IRF-1, Caspase-8, cytochrome c release from mitochondria, Caspase cascades, and inhibiting PARP, leading to intrinsic apoptotic signaling. IFN-gamma can induce fusion of human monocytes to form multinucleated giant cells and activate monocytes, increasing their ability to produce hydrogen peroxide, acid phosphatase, and plasminogen activator. IFN-gamma can enhance the sensitivity of human macrophages to lysis mediated by extracellular ATP. IFN-gamma upregulates the transcription and expression of TNF-α by inhibiting the expression of IL-10 and relieving the feedback inhibition of IL-10 on TNF-α. IFN-gamma Protein, Human (HEK293) is a recombinant interferon-gamma protein expressed in HEK293 cells without a tag.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-human-hek-293.html

Purity

95.00

Smiles

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Molecular Formula

3458 (Gene_ID) P01579 (Q24-Q166) (Accession)

Molecular Weight

Approximately 16-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Razaghi A, et al. Improved therapeutic efficacy of mammalian expressed-recombinant interferon gamma against ovarian cancer cells. Exp Cell Res. 2017 Oct 1;359 (1) :20-29. |[2]Weinberg JB, et al. Recombinant human gamma-interferon induces human monocyte polykaryon formation. Proc Natl Acad Sci U S A. 1984 Jul;81 (14) :4554-7.|[3]Blanchard DK, et al. IFN-gamma enhances sensitivity of human macrophages to extracellular ATP-mediated lysis. J Immunol. 1991 Oct 15;147 (8) :2579-85.|[4]Donnelly RP, et al. Inhibition of IL-10 expression by IFN-gamma up-regulates transcription of TNF-alpha in human monocytes. J Immunol. 1995 Aug 1;155 (3) :1420-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRDN Polyclonal Conjugated Antibody
MBS9440320-01 0.1 mL (Biotin)

TRDN Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TRDN Polyclonal Conjugated Antibody
MBS9440320-02 0.1 mL (AF350)

TRDN Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TRDN Polyclonal Conjugated Antibody
MBS9440320-03 0.1 mL (AF405)

TRDN Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TRDN Polyclonal Conjugated Antibody
MBS9440320-04 0.1 mL (AF488)

TRDN Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TRDN Polyclonal Conjugated Antibody
MBS9440320-05 0.1 mL (AF555)

TRDN Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TRDN Polyclonal Conjugated Antibody
MBS9440320-06 0.1 mL (AF594)

TRDN Polyclonal Conjugated Antibody

Sign In for Pricing
View Details