Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFN-gamma, Human (HEK293)

IFN-gamma is a cytokine. IFN-gamma can exert anticancer effects by activating p53 and p21, leading to cell cycle arrest, and/or by activating IRF-1 and Caspase-1, leading to pyroptosis, and by activating IRF-1, Caspase-8, cytochrome c release from mitochondria, Caspase cascades, and inhibiting PARP, leading to intrinsic apoptotic signaling. IFN-gamma can induce fusion of human monocytes to form multinucleated giant cells and activate monocytes, increasing their ability to produce hydrogen peroxide, acid phosphatase, and plasminogen activator. IFN-gamma can enhance the sensitivity of human macrophages to lysis mediated by extracellular ATP. IFN-gamma upregulates the transcription and expression of TNF-α by inhibiting the expression of IL-10 and relieving the feedback inhibition of IL-10 on TNF-α. IFN-gamma Protein, Human (HEK293) is a recombinant interferon-gamma protein expressed in HEK293 cells without a tag.

Product Specifications

Product Name Alternative

IFN-gamma Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ifn-gamma-protein-human-hek-293.html

Purity

95.00

Smiles

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Molecular Formula

3458 (Gene_ID) P01579 (Q24-Q166) (Accession)

Molecular Weight

Approximately 16-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Razaghi A, et al. Improved therapeutic efficacy of mammalian expressed-recombinant interferon gamma against ovarian cancer cells. Exp Cell Res. 2017 Oct 1;359 (1) :20-29. |[2]Weinberg JB, et al. Recombinant human gamma-interferon induces human monocyte polykaryon formation. Proc Natl Acad Sci U S A. 1984 Jul;81 (14) :4554-7.|[3]Blanchard DK, et al. IFN-gamma enhances sensitivity of human macrophages to extracellular ATP-mediated lysis. J Immunol. 1991 Oct 15;147 (8) :2579-85.|[4]Donnelly RP, et al. Inhibition of IL-10 expression by IFN-gamma up-regulates transcription of TNF-alpha in human monocytes. J Immunol. 1995 Aug 1;155 (3) :1420-7.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human qPCR Primer Pair
HP221322 200 Reactions

Human qPCR Primer Pair

Sign In for Pricing
View Details
DUSP8 Protein Vector (Mouse) (pPB-N-His)
PV173779 500 ng

DUSP8 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Galanthamine beta-D-Glucuronide
MBS6098633-01 0.25 mg

Galanthamine beta-D-Glucuronide

Sign In for Pricing
View Details
Galanthamine beta-D-Glucuronide
MBS6098633-02 5x 0.25 mg

Galanthamine beta-D-Glucuronide

Sign In for Pricing
View Details
Apelin Antibody HRP Conjugated
MBS9461022-01 0.1 mL

Apelin Antibody HRP Conjugated

Sign In for Pricing
View Details
Apelin Antibody HRP Conjugated
MBS9461022-02 5x 0.1 mL

Apelin Antibody HRP Conjugated

Sign In for Pricing
View Details