IFN-gamma, Human (HEK293)
IFN-gamma is a cytokine. IFN-gamma can exert anticancer effects by activating p53 and p21, leading to cell cycle arrest, and/or by activating IRF-1 and Caspase-1, leading to pyroptosis, and by activating IRF-1, Caspase-8, cytochrome c release from mitochondria, Caspase cascades, and inhibiting PARP, leading to intrinsic apoptotic signaling. IFN-gamma can induce fusion of human monocytes to form multinucleated giant cells and activate monocytes, increasing their ability to produce hydrogen peroxide, acid phosphatase, and plasminogen activator. IFN-gamma can enhance the sensitivity of human macrophages to lysis mediated by extracellular ATP. IFN-gamma upregulates the transcription and expression of TNF-α by inhibiting the expression of IL-10 and relieving the feedback inhibition of IL-10 on TNF-α. IFN-gamma Protein, Human (HEK293) is a recombinant interferon-gamma protein expressed in HEK293 cells without a tag.
Product Specifications
Product Name Alternative
IFN-gamma Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ifn-gamma-protein-human-hek-293.html
Purity
95.00
Smiles
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Molecular Formula
3458 (Gene_ID) P01579 (Q24-Q166) (Accession)
Molecular Weight
Approximately 16-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog