Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein S100-B (S100B)

This Recombinant Human Protein S100-B (S100B) spans the amino acid sequence from region 2-92. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; S100B

UniProt

P04271

Expression Region

2-92

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RALBP1 Antibody Picoband® (Dylight550 Conjugate)
A01403-1-Dylight550 100 µg

Anti-RALBP1 Antibody Picoband® (Dylight550 Conjugate)

Sign In for Pricing
View Details
FGFR1OP2, ID (FGFR1OP2, FGFR1 oncogene partner 2) (FITC) discontinued
035640-FITC 200 µL

FGFR1OP2, ID (FGFR1OP2, FGFR1 oncogene partner 2) (FITC) discontinued

Sign In for Pricing
View Details
PDIA4 antibody
10R-5213 100 µL

PDIA4 antibody

Sign In for Pricing
View Details
TNF alpha Rabbit Polyclonal Antibody
orb443224 100 µg

TNF alpha Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Leap2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3609004 1.0 µg DNA

Leap2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Placental lactogen (CSH1) Mouse Monoclonal Antibody [Clone ID: LBI2E8]
AMM13968VCF 100 µg

Placental lactogen (CSH1) Mouse Monoclonal Antibody [Clone ID: LBI2E8]

Sign In for Pricing
View Details