Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tolloid-like protein 2 (TLL2), partial

This Recombinant Human Tolloid-like protein 2 (TLL2), partial spans the amino acid sequence from region 150-349. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tolloid-like protein 2; EC 3.4.24.-; TLL2 KIAA0932

UniProt

Q9Y6L7

Expression Region

150-349

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A (CGA/414), Biotin conjugate, 0.1mg/mL
BNCB0414-100 1x 100 µL

Chromogranin A (CGA/414), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bicyclo[4.1.0]heptane-7-carboxylic Acid
TRC-C986323-500MG 500 mg

Bicyclo[4.1.0]heptane-7-carboxylic Acid

Sign In for Pricing
View Details
4-Bromo-5-pentadecylbenzene-1,3-diol
TRC-B680685-25MG 25 mg

4-Bromo-5-pentadecylbenzene-1,3-diol

Sign In for Pricing
View Details
MTUS1 Human Gene Knockout Kit (CRISPR)
KN415388 1 Kit

MTUS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PI3 Kinase p110 delta Polyclonal Antibody
E-AB-91487-01 60 µL

PI3 Kinase p110 delta Polyclonal Antibody

Sign In for Pricing
View Details
PI3 Kinase p110 delta Polyclonal Antibody
E-AB-91487-02 120 µL

PI3 Kinase p110 delta Polyclonal Antibody

Sign In for Pricing
View Details