Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tolloid-like protein 2 (TLL2), partial

This Recombinant Human Tolloid-like protein 2 (TLL2), partial spans the amino acid sequence from region 150-349. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tolloid-like protein 2; EC 3.4.24.-; TLL2 KIAA0932

UniProt

Q9Y6L7

Expression Region

150-349

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM71 Rabbit Polyclonal Antibody
TA371565 100 µL

TRIM71 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLASP1 Human Knockdown Lysate
LY300112 100 µg

CLASP1 Human Knockdown Lysate

Sign In for Pricing
View Details
ARRB2 Polyclonal Antibody
E-AB-60229-01 60 µL

ARRB2 Polyclonal Antibody

Sign In for Pricing
View Details
ARRB2 Polyclonal Antibody
E-AB-60229-02 120 µL

ARRB2 Polyclonal Antibody

Sign In for Pricing
View Details
ARRB2 Polyclonal Antibody
E-AB-60229-03 200 µL

ARRB2 Polyclonal Antibody

Sign In for Pricing
View Details
Nrsn1 (BC052019) Mouse Tagged ORF Clone
MG201937 10 µg

Nrsn1 (BC052019) Mouse Tagged ORF Clone

Sign In for Pricing
View Details