Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tolloid-like protein 2 (TLL2), partial

This Recombinant Human Tolloid-like protein 2 (TLL2), partial spans the amino acid sequence from region 150-349. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tolloid-like protein 2; EC 3.4.24.-; TLL2 KIAA0932

UniProt

Q9Y6L7

Expression Region

150-349

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SORT1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV697147 1.0 µg DNA

SORT1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rat WNT1 Inducible Signaling Pathway Protein 1 (WISP1) ELISA Kit
EKU11542 96 Tests

Rat WNT1 Inducible Signaling Pathway Protein 1 (WISP1) ELISA Kit

Sign In for Pricing
View Details
Fsd1 ORF Vector (Rat) (pORF)
20983016 1.0 µg DNA

Fsd1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Mentha piperita Cis-muuroladiene synthase, partial
MBS1335384 Inquire

Recombinant Mentha piperita Cis-muuroladiene synthase, partial

Sign In for Pricing
View Details
ILVBL Mouse Monoclonal Antibody [Clone ID: OTI1A12]
TA503080 100 µL

ILVBL Mouse Monoclonal Antibody [Clone ID: OTI1A12]

Sign In for Pricing
View Details
SMARCA6 (HELLS) Rabbit Polyclonal Antibody
TA341604 100 µL

SMARCA6 (HELLS) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details