Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-9 (TVB69)

This Recombinant Human T cell receptor beta variable 6-9 (TVB69) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-9 TRBV6-9

UniProt

A0A0J9YX75

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYLSWYRQDPGMGLRRIHYSVAAGITDKGEVPDGYNVSRSNTEDFPLRLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFQ520 Succinimidyl Ester
#80500 1x 5 mg

CFQ520 Succinimidyl Ester

Sign In for Pricing
View Details
Small Cell Lung Cancer (SCLC) (MOC-52), CF568 conjugate, 0.1mg/mL
BNC680329-500 1x 500 µL

Small Cell Lung Cancer (SCLC) (MOC-52), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMURF 2 (SMURF2) (NM_022739) Human Over-expression Lysate
LY402939 100 µg

SMURF 2 (SMURF2) (NM_022739) Human Over-expression Lysate

Sign In for Pricing
View Details
C1orf226 (NM_001085375) Human Over-expression Lysate
LC421279 20 µg

C1orf226 (NM_001085375) Human Over-expression Lysate

Sign In for Pricing
View Details
2'-Deoxy-N-(3-oxo-1-propenyl)cytidine
TRC-D330060-10MG 10 mg

2'-Deoxy-N-(3-oxo-1-propenyl)cytidine

Sign In for Pricing
View Details
2-Ethoxyaniline
TRC-E200461-10G 10 g

2-Ethoxyaniline

Sign In for Pricing
View Details