Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-9 (TVB69)

This Recombinant Human T cell receptor beta variable 6-9 (TVB69) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-9 TRBV6-9

UniProt

A0A0J9YX75

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYLSWYRQDPGMGLRRIHYSVAAGITDKGEVPDGYNVSRSNTEDFPLRLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAK3 3'UTR GFP Stable Cell Line
TU067347 1.0 mL

PAK3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-CD11b Rabbit Monoclonal Antibody
MA1687-.05 50 µL

Anti-CD11b Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Furin Rabbit Polyclonal Antibody (Biotin)
orb2623373 100 µg

Furin Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
ABHEB (ABHD14B, CIB, Abhydrolase domain-containing protein 14B, CCG1-interacting factor B) (HRP)
305739-01 50 µg

ABHEB (ABHD14B, CIB, Abhydrolase domain-containing protein 14B, CCG1-interacting factor B) (HRP)

Sign In for Pricing
View Details
ABHEB (ABHD14B, CIB, Abhydrolase domain-containing protein 14B, CCG1-interacting factor B) (HRP)
305739-02 100 µg

ABHEB (ABHD14B, CIB, Abhydrolase domain-containing protein 14B, CCG1-interacting factor B) (HRP)

Sign In for Pricing
View Details
Rabbit Anti Human No Gene Name Monoclonal Clone DAB-6 100ug
IRBAHUNo Gene NameDAB6C100ug 100 µg

Rabbit Anti Human No Gene Name Monoclonal Clone DAB-6 100ug

Sign In for Pricing
View Details