Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-13 (KV113)

This Recombinant Human Immunoglobulin kappa variable 1-13 (KV113) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-13 IGKV1-13

UniProt

P0DP09

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CaBP7 shRNA (m) Lentiviral Particles
sc-141965-V 200 µL

CaBP7 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Rab32 (NM_001108902) Rat Tagged ORF Clone
RR209995 10 µg

Rab32 (NM_001108902) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal Shigella Antibody (306/305) [HRP]
NB100-62918H 0.1 mL

Mouse Monoclonal Shigella Antibody (306/305) [HRP]

Sign In for Pricing
View Details
MyD88 Recombinant Antibody, PE Conjugated
bsm-61269R-PE-TR 20 µL

MyD88 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
PCDHGC3 Polyclonal Antibody, Cy5 Conjugated
bs-11159R-Cy5 100 µL

PCDHGC3 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Rabbit Anti-MTHFS antibody
SL17879R-01 50 µL

Rabbit Anti-MTHFS antibody

Sign In for Pricing
View Details