Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human General transcription factor II-I repeat domain-containing protein 1 (GT2D1), partial

This Recombinant Human General transcription factor II-I repeat domain-containing protein 1 (GT2D1), partial spans the amino acid sequence from region 565-650. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

General transcription factor II-I repeat domain-containing protein 1; GTF2I repeat domain-containing protein 1; General transcription factor III; MusTRD1/BEN; Muscle TFII-I repeat domain-containing protein 1; Slow-muscle-fiber enhancer-binding protein; USE B1-binding protein; Williams-Beuren syndrome chromosomal region 11 protein; Williams-Beuren syndrome chromosomal region 12 protein; GTF2IRD1 CREAM1 GTF3 MUSTRD1 RBAP2 WBSCR11 WBSCR12

UniProt

Q9UHL9

Expression Region

565-650

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LRKQVELLFNTRYAKAIGISEPVKVPYSKFLMHPEELFVVGLPEGISLRRPNCFGIAKLRKILEASNSIQFVIKRPELLTEGVKEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Liver
CP565477 150 µg

Tissue Protein Lysate, Liver

Sign In for Pricing
View Details
Slap (SLA) (NM_001045557) Human Recombinant Protein
TP761038 50 µg

Slap (SLA) (NM_001045557) Human Recombinant Protein

Sign In for Pricing
View Details
ELL3 Rabbit polyclonal Antibody
ER61160 100 µL

ELL3 Rabbit polyclonal Antibody

Sign In for Pricing
View Details
Mouse Akap1 activation kit by CRISPRa
GA200143 1 Kit

Mouse Akap1 activation kit by CRISPRa

Sign In for Pricing
View Details
Uncoated Mouse CHEM (Chemerin) ELISA Kit
E-UNEL-M0018-01 5x 96 Tests

Uncoated Mouse CHEM (Chemerin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse CHEM (Chemerin) ELISA Kit
E-UNEL-M0018-02 15x 96 Tests

Uncoated Mouse CHEM (Chemerin) ELISA Kit

Sign In for Pricing
View Details