Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692)

This Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69-2 IGHV1-69-2

UniProt

A0A0G2JMI3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGATVKISCKVSGYTFTDYYMHWVQQAPGKGLEWMGLVDPEDGETIYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nimustine Hydrochloride
TRC-N478253-100MG 100 mg

Nimustine Hydrochloride

Sign In for Pricing
View Details
cis-5-cis-13-Docosadienoic Acid
TRC-D787400-100MG 100 mg

cis-5-cis-13-Docosadienoic Acid

Sign In for Pricing
View Details
LARG (ARHGEF12) Rabbit Polyclonal Antibody
TA367117 100 µL

LARG (ARHGEF12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BPV-1 E2 tag (GVSSTSSDFRDR) Mouse Monoclonal Antibody [Clone ID: 3F12]
AM26100PU-N 100 µg

BPV-1 E2 tag (GVSSTSSDFRDR) Mouse Monoclonal Antibody [Clone ID: 3F12]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB502450 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Snrpc Mouse Gene Knockout Kit (CRISPR)
KN516404 1 Kit

Snrpc Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details