Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692)

This Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69-2 IGHV1-69-2

UniProt

A0A0G2JMI3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGATVKISCKVSGYTFTDYYMHWVQQAPGKGLEWMGLVDPEDGETIYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monbarbatain C
TN8533-01 10 mg

Monbarbatain C

Sign In for Pricing
View Details
Monbarbatain C
TN8533-02 50 mg

Monbarbatain C

Sign In for Pricing
View Details
MAN1B1 Rabbit Polyclonal Antibody (BF680)
orb2478018 100 µL

MAN1B1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
CYTH1 Protein Lysate (Rat) with C-HA Tag
17552036 100 µg

CYTH1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Cib1-set siRNA/shRNA/RNAi Lentivector (Rat)
16165096 4x 500 ng

Cib1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
DHRS7 Polyclonal Antibody
RD252605A-01 20 µL

DHRS7 Polyclonal Antibody

Sign In for Pricing
View Details