Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein BRD3OS (BRDOS)

This Recombinant Human Uncharacterized protein BRD3OS (BRDOS) spans the amino acid sequence from region 1-84. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein BRD3OS; BRD3 opposite strand protein; Long intergenic non-protein coding RNA 94; Non-protein coding RNA 94; BRD3OS LINC00094 NCRNA00094 SERLOC

UniProt

A0A1B0GUI7

Expression Region

1-84

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSGRVPLAEKALSEGYARLRYRDTSLLIWQQQQQKLESVPPGTYLSRSRSMWYSQYGNEAILVRDKNKLEVSRDTGQSKFCTIM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human TNFSF10 pAb
PA5967-01 50 μL

Rabbit Anti-Human TNFSF10 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human TNFSF10 pAb
PA5967-02 100 μL

Rabbit Anti-Human TNFSF10 pAb

Sign In for Pricing
View Details
ZNF14 Blocking Peptide
33R-4231 100 ug

ZNF14 Blocking Peptide

Sign In for Pricing
View Details
Human Ovalbumin specific Immunoglobulin G ELISA Kit
MBS731644-01 48 Well

Human Ovalbumin specific Immunoglobulin G ELISA Kit

Sign In for Pricing
View Details
Human Ovalbumin specific Immunoglobulin G ELISA Kit
MBS731644-02 96 Well

Human Ovalbumin specific Immunoglobulin G ELISA Kit

Sign In for Pricing
View Details
Human Ovalbumin specific Immunoglobulin G ELISA Kit
MBS731644-03 5x 96 Well

Human Ovalbumin specific Immunoglobulin G ELISA Kit

Sign In for Pricing
View Details