Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein BRD3OS (BRDOS)

This Recombinant Human Uncharacterized protein BRD3OS (BRDOS) spans the amino acid sequence from region 1-84. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein BRD3OS; BRD3 opposite strand protein; Long intergenic non-protein coding RNA 94; Non-protein coding RNA 94; BRD3OS LINC00094 NCRNA00094 SERLOC

UniProt

A0A1B0GUI7

Expression Region

1-84

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSGRVPLAEKALSEGYARLRYRDTSLLIWQQQQQKLESVPPGTYLSRSRSMWYSQYGNEAILVRDKNKLEVSRDTGQSKFCTIM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mstn sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6916705 3x 1.0 µg

Mstn sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Dienogest (DN)
MBS2145035-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Dienogest (DN)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Dienogest (DN)
MBS2145035-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Dienogest (DN)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Dienogest (DN)
MBS2145035-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Dienogest (DN)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Dienogest (DN)
MBS2145035-04 1 mL

Biotin-Linked Monoclonal Antibody to Dienogest (DN)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Dienogest (DN)
MBS2145035-05 5 mL

Biotin-Linked Monoclonal Antibody to Dienogest (DN)

Sign In for Pricing
View Details