Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3)

This Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3) spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3; Rhodanese domain-containing protein 3; TSTD3

UniProt

H0UI37

Expression Region

1-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKIEKCGWSEGLTSIKGNCHNFYTAISKDVTYKELKNLLNSKNIMLIDVREIWEILEYQKIPESINVPLDEVGEALQMNPRDFKEKYNEVKPSKSDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEMA4C (NM_017789) Human Over-expression Lysate
LS054910-20ug 20 µg

SEMA4C (NM_017789) Human Over-expression Lysate

Sign In for Pricing
View Details
HSP90AB1 Antibody
orb1262894 400 μl

HSP90AB1 Antibody

Sign In for Pricing
View Details
NR2E3/PNR Antibody
orb1534302 50 µg

NR2E3/PNR Antibody

Sign In for Pricing
View Details
ATG5/APG5L Polyclonal Antibody, Cy5.5 Conjugated
bs-4005R-Cy5.5 100 µL

ATG5/APG5L Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Human TNKS2, C-His Tag
HA210560-01 20 µg

Human TNKS2, C-His Tag

Sign In for Pricing
View Details
Human TNKS2, C-His Tag
HA210560-02 50 µg

Human TNKS2, C-His Tag

Sign In for Pricing
View Details