Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LBH domain-containing protein 2 (LBHD2)

This Recombinant Human LBH domain-containing protein 2 (LBHD2) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LBH domain-containing protein 2 LBHD2

UniProt

A0A0U1RRK4

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTPRPAPPQPGAAEGAGGPEGKAVAGAWEKGPRLGQRLPSIVVEPSEADPVESGELRWPLESAQRGPSQSRAAAAPSPSLPGEPGKAADNAGSECACSEDPAAPARG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast, right
CS650594 5x 5 µm

Frozen Tissue Sections, Breast, right

Sign In for Pricing
View Details
Aflatoxicol
TRC-A357543-2.5MG 2.5 mg

Aflatoxicol

Sign In for Pricing
View Details
S-(-)-Sulpiride-d3
TRC-S689142-25MG 25 mg

S-(-)-Sulpiride-d3

Sign In for Pricing
View Details
TBCEL Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A9]
TA502672AM 100 µL

TBCEL Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A9]

Sign In for Pricing
View Details
Human IRX1 activation kit by CRISPRa
GA112415 1 Kit

Human IRX1 activation kit by CRISPRa

Sign In for Pricing
View Details
C1orf135 (AUNIP) Human Gene Knockout Kit (CRISPR)
KN400831 1 Kit

C1orf135 (AUNIP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details