Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lutropin subunit beta (LSHB), Biotinylated

This Recombinant Human Lutropin subunit beta (LSHB), Biotinylated spans the amino acid sequence from region 21-141. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lutropin subunit beta; Lutropin beta chain; Luteinizing hormone subunit beta; LH-B; LSH-B; LSH-beta; LHB

UniProt

P01229

Expression Region

21-141

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEPROTL1 (NM_015344) Human Over-expression Lysate
LC402424 20 µg

LEPROTL1 (NM_015344) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Apolipoprotein A2/ApoA2 Protein (His Tag)
PKSH032083-01 10 µg

Recombinant Human Apolipoprotein A2/ApoA2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Apolipoprotein A2/ApoA2 Protein (His Tag)
PKSH032083-02 50 µg

Recombinant Human Apolipoprotein A2/ApoA2 Protein (His Tag)

Sign In for Pricing
View Details
WNK1 Recombinant Rabbit Monoclonal Antibody [JG36-91]
ET7108-41 100 µL

WNK1 Recombinant Rabbit Monoclonal Antibody [JG36-91]

Sign In for Pricing
View Details
Biotin Conjugated Caragana arborescens Lectin (Pea Tree) -CAA-
BA-6701-1 1 mg

Biotin Conjugated Caragana arborescens Lectin (Pea Tree) -CAA-

Sign In for Pricing
View Details
9-Bromo-9-phenylfluorene
TRC-B686455-2G 2 g

9-Bromo-9-phenylfluorene

Sign In for Pricing
View Details