Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small ribosomal subunit protein mS40 (RT18B), Biotinylated

This Recombinant Human Small ribosomal subunit protein mS40 (RT18B), Biotinylated spans the amino acid sequence from region 36-258. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small ribosomal subunit protein mS40; 28S ribosomal protein S18-2, mitochondrial; MRP-S18-2; 28S ribosomal protein S18b, mitochondrial; MRP-S18-b; Mrps18-b; S18mt-b; Small ribosomal subunit protein bS18b; MRPS18B C6orf14 HSPC183 PTD017

UniProt

Q9Y676

Expression Region

36-258

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

APSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBL1 Mouse Monoclonal Antibody [Clone ID: AT38G8]
AM50052PU-S 50 µL

NBL1 Mouse Monoclonal Antibody [Clone ID: AT38G8]

Sign In for Pricing
View Details
ATF2 (Ab-69 or 51) Antibody
8B7014-AAT 50 µg

ATF2 (Ab-69 or 51) Antibody

Sign In for Pricing
View Details
APC Anti-Mouse CD200/OX2 Antibody[OX-90]
E-AB-F1234UE-01 25 µg

APC Anti-Mouse CD200/OX2 Antibody[OX-90]

Sign In for Pricing
View Details
APC Anti-Mouse CD200/OX2 Antibody[OX-90]
E-AB-F1234UE-02 100 µg

APC Anti-Mouse CD200/OX2 Antibody[OX-90]

Sign In for Pricing
View Details
RBM44 Human Gene Knockout Kit (CRISPR)
KN416835 1 Kit

RBM44 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IGF1 (NM_000618) Human Recombinant Protein
TP720023M 50 µg

IGF1 (NM_000618) Human Recombinant Protein

Sign In for Pricing
View Details