Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34)

This Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-4 IGHV4-30-4

UniProt

P0DP06

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sealing Mats
DPMATS-3-PRT 50 Pack/Case

Sealing Mats

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR560220 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
MAP1LC3A Human Knockdown Lysate
LY300232 100 µg

MAP1LC3A Human Knockdown Lysate

Sign In for Pricing
View Details
Human Cadherin, Heart (CDHH) ELISA Kit
RDR-CDHH-Hu-01 96 Tests

Human Cadherin, Heart (CDHH) ELISA Kit

Sign In for Pricing
View Details
Human Cadherin, Heart (CDHH) ELISA Kit
RDR-CDHH-Hu-02 48 Tests

Human Cadherin, Heart (CDHH) ELISA Kit

Sign In for Pricing
View Details
2,5-Dihydroxy-1,4-benzoquinone
TRC-D447105-5G 5 g

2,5-Dihydroxy-1,4-benzoquinone

Sign In for Pricing
View Details