Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34)

This Recombinant Human Immunoglobulin heavy variable 4-30-4 (HVD34) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-4 IGHV4-30-4

UniProt

P0DP06

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIGYIYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STYX (Serine/Threonine/Tyrosine-interacting Protein, Protein Tyrosine Phosphatase-like Protein) (MaxLight 650)
MBS6501429-01 0.1 mL

STYX (Serine/Threonine/Tyrosine-interacting Protein, Protein Tyrosine Phosphatase-like Protein) (MaxLight 650)

Sign In for Pricing
View Details
STYX (Serine/Threonine/Tyrosine-interacting Protein, Protein Tyrosine Phosphatase-like Protein) (MaxLight 650)
MBS6501429-02 5x 0.1 mL

STYX (Serine/Threonine/Tyrosine-interacting Protein, Protein Tyrosine Phosphatase-like Protein) (MaxLight 650)

Sign In for Pricing
View Details
Polyclonal Antibody to Ribonuclease A9 (RNASE9)
TRV-0049067-01 20 µL

Polyclonal Antibody to Ribonuclease A9 (RNASE9)

Sign In for Pricing
View Details
Polyclonal Antibody to Ribonuclease A9 (RNASE9)
TRV-0049067-02 100 µL

Polyclonal Antibody to Ribonuclease A9 (RNASE9)

Sign In for Pricing
View Details
Polyclonal Antibody to Ribonuclease A9 (RNASE9)
TRV-0049067-03 200 µL

Polyclonal Antibody to Ribonuclease A9 (RNASE9)

Sign In for Pricing
View Details
Polyclonal Antibody to Ribonuclease A9 (RNASE9)
TRV-0049067-04 1 mL

Polyclonal Antibody to Ribonuclease A9 (RNASE9)

Sign In for Pricing
View Details