Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-66 (HV366), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-66 (HV366), Biotinylated spans the amino acid sequence from region 20-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-66 IGHV3-66

UniProt

A0A0C4DH42

Expression Region

20-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLIQPGGSLRLSCAASGFTVSSNYMSWVRQAPGKGLEWVSVIYSCGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fgf12 (NM_001276419) Mouse Tagged ORF Clone
MR228511 10 µg

Fgf12 (NM_001276419) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Phospho-MSK1 (Ser376) Rabbit Monoclonal Antibody
AF2200 50 µL

Phospho-MSK1 (Ser376) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
S100A8 Monoclonal Antibody
orb359363 100 µg

S100A8 Monoclonal Antibody

Sign In for Pricing
View Details
Chicken heat shock protein 70 (Hsp-70) ELISA Kit
EIA05823Ch 1 Kit

Chicken heat shock protein 70 (Hsp-70) ELISA Kit

Sign In for Pricing
View Details
2-Nitrophenol-13C6
TRC-N496908-1MG 1 mg

2-Nitrophenol-13C6

Sign In for Pricing
View Details
SU-1498
abx076711-01 5 mg

SU-1498

Sign In for Pricing
View Details