Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-70D IGHV2-70D

UniProt

A0A0C4DH43

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKFYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal FGFR4 Antibody (249) [mFluor Violet 450 SE]
NBP2-89557MFV450 0.1 mL

Rabbit Monoclonal FGFR4 Antibody (249) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Oct-2 Rabbit mAb
MBS9470555-01 0.05 mL

Oct-2 Rabbit mAb

Sign In for Pricing
View Details
Oct-2 Rabbit mAb
MBS9470555-02 0.1 mL

Oct-2 Rabbit mAb

Sign In for Pricing
View Details
Oct-2 Rabbit mAb
MBS9470555-03 5x 0.1 mL

Oct-2 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila pyrD Protein (aa 1-333) (strain Paris)
VAng-Lsx04478-1mgEcoli 1 mg (E. coli)

Recombinant Legionella Pneumophila pyrD Protein (aa 1-333) (strain Paris)

Sign In for Pricing
View Details
Hnrnpc ORF Vector (Mouse) (pORF)
ORF047334 1.0 µg DNA

Hnrnpc ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details