Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-8 (KV108), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-8 (KV108), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-8 IGKV1-8

UniProt

A0A0C4DH67

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIRMTQSPSSFSASTGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDO1 shRNA Plasmid (h)
sc-91642-SH 20 µg

CDO1 shRNA Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human Ezrin (EZR)
MBS954384-01 0.02 mg (E-Coli)

Recombinant Human Ezrin (EZR)

Sign In for Pricing
View Details
Recombinant Human Ezrin (EZR)
MBS954384-02 0.02 mg (Yeast)

Recombinant Human Ezrin (EZR)

Sign In for Pricing
View Details
Recombinant Human Ezrin (EZR)
MBS954384-03 0.1 mg (E-Coli)

Recombinant Human Ezrin (EZR)

Sign In for Pricing
View Details
Recombinant Human Ezrin (EZR)
MBS954384-04 0.1 mg (Yeast)

Recombinant Human Ezrin (EZR)

Sign In for Pricing
View Details
Recombinant Human Ezrin (EZR)
MBS954384-05 0.02 mg (Baculovirus)

Recombinant Human Ezrin (EZR)

Sign In for Pricing
View Details