Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-9 (KV109), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-9 (KV109), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-9 IGKV1-9

UniProt

A0A0C4DH69

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ammonium-15N Chloride
TRC-A633852-5G 5 g

Ammonium-15N Chloride

Sign In for Pricing
View Details
Sodium 3-Nitrobenzenesulfonate
TRC-S648010-5G 5 g

Sodium 3-Nitrobenzenesulfonate

Sign In for Pricing
View Details
Human DIXDC1 activation kit by CRISPRa
GA113897 1 Kit

Human DIXDC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human GFAP ELISA KIT (1 x 96 wells)
EA200012 96 Well

Human GFAP ELISA KIT (1 x 96 wells)

Sign In for Pricing
View Details
Bis(2-butoxyethyl) 2-Hydroxyethyl-d4 Phosphate Triester
TRC-B415192-2.5MG 2.5 mg

Bis(2-butoxyethyl) 2-Hydroxyethyl-d4 Phosphate Triester

Sign In for Pricing
View Details
3Alpha-Phenylacetoxy Tropane-d5
TRC-P306102-10MG 10 mg

3Alpha-Phenylacetoxy Tropane-d5

Sign In for Pricing
View Details