Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-9 (KV109), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-9 (KV109), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-9 IGKV1-9

UniProt

A0A0C4DH69

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS633519 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
(+)-ar-Turmerone
TRC-T897275-5MG 5 mg

(+)-ar-Turmerone

Sign In for Pricing
View Details
CD20 (MS4A1) Mouse Monoclonal Antibody [Clone ID: B-H20]
AM31222AF-N 200 µg

CD20 (MS4A1) Mouse Monoclonal Antibody [Clone ID: B-H20]

Sign In for Pricing
View Details
SAPK4 (MAPK13) (NM_002754) Human Over-expression Lysate
LY400973 100 µg

SAPK4 (MAPK13) (NM_002754) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TEM8 (ANTXR1) activation kit by CRISPRa
GA113404 1 Kit

Human TEM8 (ANTXR1) activation kit by CRISPRa

Sign In for Pricing
View Details
Acid Red 26 (>80%)
TRC-A189845-5G 5 g

Acid Red 26 (>80%)

Sign In for Pricing
View Details