Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-9 (KV109), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-9 (KV109), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-9 IGKV1-9

UniProt

A0A0C4DH69

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Chlorobenzyl Bromide
TRC-C427623-500MG 500 mg

4-Chlorobenzyl Bromide

Sign In for Pricing
View Details
Vicine-13C,15N3
TRC-V250019-1MG 1 mg

Vicine-13C,15N3

Sign In for Pricing
View Details
Plakophilin 1 (PKP1) (NM_001005337) Human Over-expression Lysate
LC423863 20 µg

Plakophilin 1 (PKP1) (NM_001005337) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin, HMW (34BE12), Biotin conjugate, 0.1mg/mL
BNCB0446-500 1x 500 µL

Cytokeratin, HMW (34BE12), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 Recombinant Rabbit monoclonal Antibody [SU03-59]
ET1608-48-50UL 50 µL

CD31 Recombinant Rabbit monoclonal Antibody [SU03-59]

Sign In for Pricing
View Details
Glypican-3 (GPC3/863 + 1G12), CF488A conjugate, 0.1mg/mL
BNC880864-100 1x 100 µL

Glypican-3 (GPC3/863 + 1G12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details