Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-9 (KV109), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-9 (KV109), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-9 IGKV1-9

UniProt

A0A0C4DH69

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQLTQSPSFLSASVGDRVTITCRASQGISSYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Feline Immunodeficiency Virus (FIV-p24) Antibody
MBS569524-01 1 mg

Feline Immunodeficiency Virus (FIV-p24) Antibody

Sign In for Pricing
View Details
Feline Immunodeficiency Virus (FIV-p24) Antibody
MBS569524-02 5x 1 mg

Feline Immunodeficiency Virus (FIV-p24) Antibody

Sign In for Pricing
View Details
MPV17 Knockout MES-OV Polyclonal Cells
ARG6542 1 Million

MPV17 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum Sulfoxide reductase catalytic subunit YedY (yedY)
MBS1193278-01 0.02 mg (E-Coli)

Recombinant Pectobacterium carotovorum subsp. carotovorum Sulfoxide reductase catalytic subunit YedY (yedY)

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum Sulfoxide reductase catalytic subunit YedY (yedY)
MBS1193278-02 0.02 mg (Yeast)

Recombinant Pectobacterium carotovorum subsp. carotovorum Sulfoxide reductase catalytic subunit YedY (yedY)

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum Sulfoxide reductase catalytic subunit YedY (yedY)
MBS1193278-03 0.1 mg (E-Coli)

Recombinant Pectobacterium carotovorum subsp. carotovorum Sulfoxide reductase catalytic subunit YedY (yedY)

Sign In for Pricing
View Details