Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-6 (KV106), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-6 (KV106), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-6 IGKV1-6

UniProt

A0A0C4DH72

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Omentum
CS804266 5x 5 µm

Tissue FFPE Sections, Omentum

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (ATG5/2492), CF640R conjugate, 0.1mg/mL
BNC402492-100 1x 100 µL

ATG5 (Autophagy Marker) (ATG5/2492), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), Biotin conjugate, 0.1mg/mL
BNCB1099-500 1x 500 µL

CD31 / PECAM-1 (C31.3 + C31.7 + C31.10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zfp53 Mouse Gene Knockout Kit (CRISPR)
KN519871 1 Kit

Zfp53 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgG Immunoglobulin (ICO-97), CF647 conjugate, 0.1mg/mL
BNC470758-500 1x 500 µL

Human IgG Immunoglobulin (ICO-97), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PROCR Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF805527 100 µg

PROCR Mouse Monoclonal Antibody [Clone ID: OTI2D11]

Sign In for Pricing
View Details