Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1-12 (KV112), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1-12 (KV112), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1-12 IGKV1-12

UniProt

A0A0C4DH73

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSSVSASVGDRVTITCRASQGISSWLAWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQANSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hdac2 shRNA (UAS) - Lentiviral mouse Hdac2 shRNA (UAS, GFP) (100)
GTR15276117 1 Vial

Lentiviral mouse Hdac2 shRNA (UAS) - Lentiviral mouse Hdac2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
EN2 Antibody - C-terminal region
MBS3200398-01 0.1 mL

EN2 Antibody - C-terminal region

Sign In for Pricing
View Details
EN2 Antibody - C-terminal region
MBS3200398-02 5x 0.1 mL

EN2 Antibody - C-terminal region

Sign In for Pricing
View Details
Pigeon Arylalkylamine N-Acetyltransferase ELISA Kit
MBS070062 Inquire

Pigeon Arylalkylamine N-Acetyltransferase ELISA Kit

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida PM0747 Protein (aa 1-195)
VAng-Cr7110-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida PM0747 Protein (aa 1-195)

Sign In for Pricing
View Details
BLOCK ACE
MBS238969 20x 4 g

BLOCK ACE

Sign In for Pricing
View Details