Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69-2 IGHV1-69-2

UniProt

A0A0G2JMI3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGATVKISCKVSGYTFTDYYMHWVQQAPGKGLEWMGLVDPEDGETIYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIPN CRISPR Activation Plasmid (m)
sc-427634-ACT 20 µg

LIPN CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
SGK1 Mouse Monoclonal Antibody (4D12)
E44H11232 100 µL

SGK1 Mouse Monoclonal Antibody (4D12)

Sign In for Pricing
View Details
DARS, NT (DARS, Aspartate-tRNA ligase, cytoplasmic, Aspartyl-tRNA synthetase, Cell proliferation-inducing gene 40 protein) (PE)
MBS6290858-01 0.2 mL

DARS, NT (DARS, Aspartate-tRNA ligase, cytoplasmic, Aspartyl-tRNA synthetase, Cell proliferation-inducing gene 40 protein) (PE)

Sign In for Pricing
View Details
DARS, NT (DARS, Aspartate-tRNA ligase, cytoplasmic, Aspartyl-tRNA synthetase, Cell proliferation-inducing gene 40 protein) (PE)
MBS6290858-02 5x 0.2 mL

DARS, NT (DARS, Aspartate-tRNA ligase, cytoplasmic, Aspartyl-tRNA synthetase, Cell proliferation-inducing gene 40 protein) (PE)

Sign In for Pricing
View Details
Rat Monoclonal Claudin-1 Antibody (421203) [Janelia Fluor 635]
FAB4618JF635 0.1 mL

Rat Monoclonal Claudin-1 Antibody (421203) [Janelia Fluor 635]

Sign In for Pricing
View Details
LGALS4 Recombinant Protein
OPCD03406-50UG 50 µg

LGALS4 Recombinant Protein

Sign In for Pricing
View Details