Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 5-39 (LV539), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 5-39 (LV539), Biotinylated spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 5-39 IGLV5-39

UniProt

A0A0G2JS06

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPTSLSASPGASARFTCTLRSGINVGTYRIYWYQQKPGSLPRYLLRYKSDSDKQQGSGVPSRFSGSKDASTNAGLLLISGLQSEDEADYYCAIWYSSTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC15A1 Adenovirus (Human)
43886051 1.0 mL

SLC15A1 Adenovirus (Human)

Sign In for Pricing
View Details
Chicken HSPA1A ELISA Kit
ECKH0130 96 Tests

Chicken HSPA1A ELISA Kit

Sign In for Pricing
View Details
Mouse Non Swiss Albino Plasma
IMSNSAPLAK3E50ML 1 Each

Mouse Non Swiss Albino Plasma

Sign In for Pricing
View Details
Chtf18 (NM_001105773) Rat Tagged ORF Clone
RR206258 10 µg

Chtf18 (NM_001105773) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Equine Glucagon Like Peptide 1 (GLP1) ELISA Kit
RDR-GLP1-Eq-96Tests 96 Tests

Equine Glucagon Like Peptide 1 (GLP1) ELISA Kit

Sign In for Pricing
View Details
PTGES3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV696661 1.0 µg DNA

PTGES3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details