Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 7-4-1 IGHV7-4-1

UniProt

A0A0J9YVY3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGSELKKPGASVKVSCKASGYTFTSYAMNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQICSLKAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09803A-01 25 µg

Purified Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Purified Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09803A-02 100 µg

Purified Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Transfer Pipettes
P4123-01 400 Units/Pack

Transfer Pipettes

Sign In for Pricing
View Details
Human MFSD14C activation kit by CRISPRa
GA113475 1 Kit

Human MFSD14C activation kit by CRISPRa

Sign In for Pricing
View Details
Syntaxin 3 (STX3) Mouse Monoclonal Antibody [Clone ID: OTI5B12]
CF811075 100 µg

Syntaxin 3 (STX3) Mouse Monoclonal Antibody [Clone ID: OTI5B12]

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (rLAMP4/824), CF640R conjugate, 0.1mg/mL
BNC403434-500 1x 500 µL

CD68 (Macrophage Marker) (rLAMP4/824), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details