Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 7-4-1 IGHV7-4-1

UniProt

A0A0J9YVY3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGSELKKPGASVKVSCKASGYTFTSYAMNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQICSLKAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Microspheres PS, S/DVB 0.125µm, PS02N
PS02005-5.0 5.0 g

Microspheres PS, S/DVB 0.125µm, PS02N

Sign In for Pricing
View Details
LIPF (10A8) Rabbit Monoclonal Antibody
E28M2361 100 µL

LIPF (10A8) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ANO1 / TMEM16A Reference Antibody
orb1806026-01 100 µg

ANO1 / TMEM16A Reference Antibody

Sign In for Pricing
View Details
ANO1 / TMEM16A Reference Antibody
orb1806026-02 1 mg

ANO1 / TMEM16A Reference Antibody

Sign In for Pricing
View Details
Rat Monoclonal IL-20 R beta/FNDC6 Antibody (20RNTC) [Janelia Fluor 525]
NBP2-00466JF525 0.1 mL

Rat Monoclonal IL-20 R beta/FNDC6 Antibody (20RNTC) [Janelia Fluor 525]

Sign In for Pricing
View Details
CHP, ID (Calcium-binding protein p22, Calcium-binding protein CHP, Calcineurin homologous protein, Calcineurin B homolog, CHP) (AP)
MBS6285755-01 0.2 mL

CHP, ID (Calcium-binding protein p22, Calcium-binding protein CHP, Calcineurin homologous protein, Calcineurin B homolog, CHP) (AP)

Sign In for Pricing
View Details