Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-9 (TVB69), Biotinylated

This Recombinant Human T cell receptor beta variable 6-9 (TVB69), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-9 TRBV6-9

UniProt

A0A0J9YX75

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFHILKTGQSMTLQCAQDMNHGYLSWYRQDPGMGLRRIHYSVAAGITDKGEVPDGYNVSRSNTEDFPLRLESAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCG3 (DNAJB3) (NM_001001394) Human Recombinant Protein
TP305526 20 µg

HCG3 (DNAJB3) (NM_001001394) Human Recombinant Protein

Sign In for Pricing
View Details
Pigeon SH3 Domain Binding Protein 2 ELISA Kit
MBS092220 Inquire

Pigeon SH3 Domain Binding Protein 2 ELISA Kit

Sign In for Pricing
View Details
Bovine yippee-like 3 (Drosophila) ELISA Kit
OM624662 96 Strip Well

Bovine yippee-like 3 (Drosophila) ELISA Kit

Sign In for Pricing
View Details
Active Cathepsin D (CTSD)
MBS2162353-01 0.01 mg

Active Cathepsin D (CTSD)

Sign In for Pricing
View Details
Active Cathepsin D (CTSD)
MBS2162353-02 0.05 mg

Active Cathepsin D (CTSD)

Sign In for Pricing
View Details
Active Cathepsin D (CTSD)
MBS2162353-03 0.1 mg

Active Cathepsin D (CTSD)

Sign In for Pricing
View Details