Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 5-10-1 (HV5X1), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 5-10-1 (HV5X1), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 5-10-1 IGHV5-10-1

UniProt

A0A0J9YXX1

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGESLRISCKGSGYSFTSYWISWVRQMPGKGLEWMGRIDPSDSYTNYSPSFQGHVTISADKSISTAYLQWSSLKASDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-500 1x 500 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (GFR450), CF740 conjugate, 0.1mg/mL
BNC740450-100 1x 100 µL

EGFR (GFR450), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/486), CF405S conjugate, 0.1mg/mL
BNC040486-500 1x 500 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/486), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), CF647 conjugate, 0.1mg/mL
BNC472146-100 1x 100 µL

PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details