Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-1 (TVBJ1), Biotinylated

This Recombinant Human T cell receptor beta variable 10-1 (TVBJ1), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-1 TRBV10-1

UniProt

A0A0K0K1A3

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EITQSPRHKITETGRQVTLACHQTWNHNNMFWYRQDLGHGLRLIHYSYGVHDTNKGEVSDGYSVSRSNTEDLPLTLESAASSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL
BNC431050-100 1x 100 µL

CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-100 1x 100 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-500 1x 500 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CELA3B (CELA3B/1218), CF405S conjugate, 0.1mg/mL
BNC041218-500 1x 500 µL

CELA3B (CELA3B/1218), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2479), CF640R conjugate, 0.1mg/mL
BNC402479-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/2479), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details